1. 3 days ago 
    Awesome T-Rex cake! #caysenbday #dinosaur #rawr

    Awesome T-Rex cake! #caysenbday #dinosaur #rawr

     
  2. 4 days ago 
    Tasting the full flight! #honolulu #beerworks #pauhana  (at Honolulu Beerworks)

    Tasting the full flight! #honolulu #beerworks #pauhana (at Honolulu Beerworks)

     
  3. 1 week ago 
    My first homemade smoothie. I think I ruined it by putting a scoop of whey protein. #yuck

    My first homemade smoothie. I think I ruined it by putting a scoop of whey protein. #yuck

     
  4. 1 week ago 
    I think I found my personal care physician… maybe. #woof (at Waianae District Park (Gym))

    I think I found my personal care physician… maybe. #woof (at Waianae District Park (Gym))

     
  5. 1 week ago 
    Ah! Still celebrating marriage. Thanks to my coworkers @Kiki_chambers @brent_suyama & the other edu peeps for the cake! This piece🍰 is saved for the huz, @skchillingworth

    Ah! Still celebrating marriage. Thanks to my coworkers @Kiki_chambers @brent_suyama & the other edu peeps for the cake! This piece🍰 is saved for the huz, @skchillingworth

     
  6. 2 weeks ago 
    I don’t care what anyone says. THIS is the best shave ice place! #mountainmagic #snowcap #mochiballs  (at Mountain Magic Shave Ice)

    I don’t care what anyone says. THIS is the best shave ice place! #mountainmagic #snowcap #mochiballs (at Mountain Magic Shave Ice)

     
  7. Notes: 1 / 2 weeks ago 
    Was winnaz!!! #hawaiianfood #highwayinn #kakaako #laulau #lomisalmon #squidluau #haupia #sweetpotatoforthehuz #ono #kaukau #localkinegrindz #luckywelivehawaii #hilife  (at Highway Inn)

    Was winnaz!!! #hawaiianfood #highwayinn #kakaako #laulau #lomisalmon #squidluau #haupia #sweetpotatoforthehuz #ono #kaukau #localkinegrindz #luckywelivehawaii #hilife (at Highway Inn)

     
  8. 2 weeks ago 
    Hawaiian food for dinnah! #highwayinn #kakaako #alohafriday (at Highway Inn)

    Hawaiian food for dinnah! #highwayinn #kakaako #alohafriday (at Highway Inn)

     
  9. Notes: 2 / 3 weeks ago 
    Drinking in honor of our quick stint in #belgium #chimay #belgian #beer  (at Mariposa)

    Drinking in honor of our quick stint in #belgium #chimay #belgian #beer (at Mariposa)

     
  10. 3 weeks ago 
    #Pizza & #gummibears for this state #holiday lunch. #princekuhio #dayoff (at Whole Foods Market Kahala)

    #Pizza & #gummibears for this state #holiday lunch. #princekuhio #dayoff (at Whole Foods Market Kahala)

     
avatar_128
 
 
Must there really be a better answer to the question, "why?" than "jess_because"??
 
 
View jess_because's check-ins on GetGlue

View jess_because's stickers on GetGlue

Following

fallontonighttotalfilmfotojournalismusshortformblogshumbodynamedharryyoisthisracistgoodmorningamericahitrecordjoefymodernfamilyilovechartsnewsweekvanityfairstafftodayentertainmentweeklytvhangoverjhnmyrvintage-visualsnikkeijinhawaiitowfriendscapstvandgumareawesomemashablehqhuffposttvgabebondocdear-photographperezhamiltonnetworkawesomebandhjaredwongcbstelevisionstudiosbuckhollywoodhawaiiadobothehotrainbandfoxtvpamcakezbrokedamouthstarbucksspellingcrucialpizzajohnmayergleeonfoxlegoexpressmikographythecinemaniacallthetvshitthatsirisaysthegrassisgreenfoodspottingdailygummybeartextsfromhillaryclintonorangegummybearamenfashionnumbr3pamcakez2love
 

Tumblr